PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_005880-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 301aa    MW: 33737 Da    PI: 7.2774
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_005880-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding612.6e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEdellv++++q+G g+W++ ++  g+ R++k+c++rw +yl
  AHYPO_005880-RA 14 KGPWTSEEDELLVKYINQHGHGNWRSLPKNAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding48.52e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      r ++T eE++l +++++ lG++ W++Ia+ ++ gRt++++k+ w+++l
  AHYPO_005880-RA  67 RCPFTLEEEKLVIQLHAILGNR-WAAIAAQLP-GRTDNEIKNLWNTHL 112
                      679*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-24563IPR009057Homeodomain-like
PROSITE profilePS5129417.805961IPR017930Myb domain
SuperFamilySSF466892.42E-3111108IPR009057Homeodomain-like
SMARTSM007171.7E-151363IPR001005SANT/Myb domain
PfamPF002497.4E-171461IPR001005SANT/Myb domain
CDDcd001672.40E-121661No hitNo description
PROSITE profilePS5129424.80562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.1E-2564117IPR009057Homeodomain-like
SMARTSM007173.3E-1466114IPR001005SANT/Myb domain
PfamPF002492.3E-1467112IPR001005SANT/Myb domain
CDDcd001675.34E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009909Biological Processregulation of flower development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MGRSPCCDKV GLKKGPWTSE EDELLVKYIN QHGHGNWRSL PKNAGLLRCG KSCRLRWTNY  60
LRPDIKRCPF TLEEEKLVIQ LHAILGNRWA AIAAQLPGRT DNEIKNLWNT HLKKRLISMG  120
IDPQTHEPSK PITNPPASPS TRHMTQWESA RLEAEARLSS ESLLSHAHSS VILDSDHFLR  180
LWNSEVGESF RKNEKKEKLV CQSPISQAST STTKFASTSG LTVENRDVES ICKTIIKSES  240
GDANTKSDSS SSNEAEYTTE SALQLLLDFP GSDDMSFLQD PIHEFSSIFQ SVMNQQLNFI  300
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-281211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00114ampDAPTransfer from AT3G61250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010672001.11e-175PREDICTED: myb-related protein Myb4
SwissprotQ50EX66e-66ODO1_PETHY; Protein ODORANT1
TrEMBLA0A0J8D8E21e-175A0A0J8D8E2_BETVU; Uncharacterized protein
STRINGVIT_15s0046g03190.t011e-137(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.11e-103myb domain protein 17